PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Jcr4S00077.70
Common NameJCGZ_24594, LOC105631288
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Jatropheae; Jatropha
Family MYB
Protein Properties Length: 578aa    MW: 62680.6 Da    PI: 5.0112
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Jcr4S00077.70genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.46.7e-184087148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT  Ed +l+++vk++G g+W+++ ++ g+ R++k+c++rw ++l
    Jcr4S00077.70 40 KGPWTSAEDAILIEYVKKHGEGNWNAVQKHSGLSRCGKSCRLRWANHL 87
                     79******************************************9986 PP

2Myb_DNA-binding40.37.5e-1393157146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHT....................TTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmg....................kgRtlkqcksrwqk 46 
                      +g++T+eE++l++++++++G++ W++ a++++                    +gRt++++k++w++
    Jcr4S00077.70  93 KGAFTQEEEQLIIELHAKMGNK-WARMAAHIPefksrlvpmetfisfmytscLGRTDNEIKNYWNT 157
                      799*******************.*****************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129423.5483591IPR017930Myb domain
SMARTSM007173.6E-163989IPR001005SANT/Myb domain
PfamPF002494.4E-164087IPR001005SANT/Myb domain
SuperFamilySSF466894.3E-2541117IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.608.0E-254194IPR009057Homeodomain-like
CDDcd001673.66E-124287No hitNo description
PROSITE profilePS5129415.6192163IPR017930Myb domain
SMARTSM007179.3E-1392161IPR001005SANT/Myb domain
PfamPF002493.8E-1293157IPR001005SANT/Myb domain
CDDcd001673.72E-895157No hitNo description
Gene3DG3DSA:1.10.10.604.5E-2395162IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009789Biological Processpositive regulation of abscisic acid-activated signaling pathway
GO:0043068Biological Processpositive regulation of programmed cell death
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0045926Biological Processnegative regulation of growth
GO:0048235Biological Processpollen sperm cell differentiation
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 578 aa     Download sequence    Send to blast
MSHTTSESDD GVLSKDRADS PLAEEGSCGG SANGGIVLKK GPWTSAEDAI LIEYVKKHGE  60
GNWNAVQKHS GLSRCGKSCR LRWANHLRPN LKKGAFTQEE EQLIIELHAK MGNKWARMAA  120
HIPEFKSRLV PMETFISFMY TSCLGRTDNE IKNYWNTRIK RRQRAGLPLY PPEVSLQALQ  180
ESQRGLNVGG ISTGDKGHQD LMRTNSYEIP DVIFDSLKAN QGISPYVSEL PDISASSILV  240
KGLGSSQYGS FMSPSVHRQK RFRESTTLIP GYSGGVKTEF PLFDQFQDNS CDKVAQSFGL  300
SFPFDPDPTN KNPQSFCDNQ GGHTLANGDF SASKPNSGPL KMELPSLQYP ENDLGSWGTS  360
PPHLLETVDT FIQSPPTGAV ESSPRNSGLL DALLHEAKTL SSAKNHSSDK SSNSSTVTPG  420
ELAESSALNI CGAEWEDYGD PLSPLGHTAT SLFSDCTPIS ASGSSLDEPP PTETFTGCNV  480
KSELVDQAWS PERERETTNR LDITRPDALL ASDWLGQGSG YVKEQVIMAD NIATLLGDDL  540
SSDYKQISAG ASTSNQGWGL GSCAWNNMPA VCQMSELP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-28381625107B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00490DAPTransfer from AT5G06100Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKM0346480.0KM034648.1 Jatropha curcas clone JcMYB028 MYB family protein gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012068750.10.0PREDICTED: transcription factor GAMYB-like
RefseqXP_012068751.10.0PREDICTED: transcription factor GAMYB-like
RefseqXP_012068752.10.0PREDICTED: transcription factor GAMYB-like
TrEMBLA0A067L7W60.0A0A067L7W6_JATCU; MYB family protein
STRINGPOPTR_0003s18900.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20473485
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06100.31e-143myb domain protein 33
Publications ? help Back to Top
  1. Zhang L, et al.
    Global analysis of gene expression profiles in physic nut (Jatropha curcas L.) seedlings exposed to salt stress.
    PLoS ONE, 2014. 9(5): p. e97878
    [PMID:24837971]